PDB entry 3d27

View 3d27 on RCSB PDB site
Description: E. coli methionine aminopeptidase with Fe inhibitor W29
Class: hydrolase
Keywords: dinuclear, manganese, iron, hydrolase, peptidase, enzyme-inhibitor complex, metalloenzyme, Aminopeptidase, Cobalt, Metal-binding, Protease
Deposited on 2008-05-07, released 2008-08-19
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-14, with a file datestamp of 2008-10-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Gene: map, b0168, JW0163
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3d27a1
  • Heterogens: MN, W29, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3d27A (A:)
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde