PDB entry 3d24

View 3d24 on RCSB PDB site
Description: Crystal structure of ligand-binding domain of estrogen-related receptor alpha (ERRalpha) in complex with the peroxisome proliferators-activated receptor coactivator-1alpha box3 peptide (PGC-1alpha)
Class: transcription
Keywords: nuclear receptor, ligand binding domain, coactivator, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Zinc, Zinc-finger, Polymorphism, RNA-binding, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2008-05-07, released 2008-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid hormone receptor ERR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRA, ERR1, ESRL1, NR3B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d24a1
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Steroid hormone receptor ERR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRA, ERR1, ESRL1, NR3B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d24c1
  • Chain 'D':
    Compound: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d24A (A:)
    mrshhhhhhgpglvprgsktaapvnalvshllvvepeklyampdpagpdghlpavatlcd
    lfdreivvtiswaksipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedl
    vldeegaraaglgelgaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveq
    lrealhealleyeagragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpm
    hklflemleammd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d24A (A:)
    vnalvshllvvepeklyampavatlcdlfdreivvtiswaksipgfsslslsdqmsvlqs
    vwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrlqalrler
    eeyvllkalalansdsvhiedaeaveqlrealhealleyeagerrragrllltlpllrqt
    agkvlahfygvklegkvpmhklflemlea
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d24C (C:)
    mrshhhhhhgpglvprgsktaapvnalvshllvvepeklyampdpagpdghlpavatlcd
    lfdreivvtiswaksipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedl
    vldeegaraaglgelgaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveq
    lrealhealleyeagragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpm
    hklflemleammd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d24C (C:)
    apvnalvshllvvepeklyamppavatlcdlfdreivvtiswaksipgfsslslsdqmsv
    lqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrlqalr
    lereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrarrragrllltlpl
    lrqtagkvlahfygvklegkvpmhklflemleammd
    

  • Chain 'D':
    No sequence available.