PDB entry 3d22

View 3d22 on RCSB PDB site
Description: Crystal structure of a poplar thioredoxin h mutant, PtTrxh4C61S
Class: oxidoreductase
Keywords: thioredoxin h, Electron transport, Cytoplasm, Redox-active center, Transport, OXIDOREDUCTASE
Deposited on 2008-05-07, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin H-type
    Species: Populus trichocarpa x Populus deltoides [TaxId:3695]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P85801 (Start-138)
      • engineered (60-61)
    Domains in SCOPe 2.07: d3d22a1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d22A (A:)
    mglclakrnhdadddephielaggnvhlittkerwdqklseasrdgkivlanfsarwcgp
    srqiapyyielsenypslmflvidvdelsdfsasweikatptffflrdgqqvdklvgank
    pelhkkitaildslppsdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d22A (A:)
    glclaephielaggnvhlittkerwdqklseasrdgkivlanfsarwcgpsrqiapyyie
    lsenypslmflvidvdelsdfsasweikatptffflrdgqqvdklvgankpelhkkitai
    ldslppsdk