PDB entry 3d21

View 3d21 on RCSB PDB site
Description: Crystal structure of a poplar wild-type thioredoxin h, PtTrxh4
Class: oxidoreductase
Keywords: thioredoxin h, Electron transport, Transport, Cytoplasm, Redox-active center, OXIDOREDUCTASE
Deposited on 2008-05-07, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin H-type
    Species: Populus trichocarpa x Populus deltoides [TaxId:3695]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d21a_
  • Chain 'B':
    Compound: Thioredoxin H-type
    Species: Populus trichocarpa x Populus deltoides [TaxId:3695]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d21b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d21A (A:)
    mglclakrnhdadddephielaggnvhlittkerwdqklseasrdgkivlanfsarwcgp
    ckqiapyyielsenypslmflvidvdelsdfsasweikatptffflrdgqqvdklvgank
    pelhkkitaildslppsdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d21A (A:)
    gnvhlittkerwdqklseasrdgkivlanfsarwcgpckqiapyyielsenypslmflvi
    dvdelsdfsasweikatptffflrdgqqvdklvgankpelhkkitaildsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d21B (B:)
    mglclakrnhdadddephielaggnvhlittkerwdqklseasrdgkivlanfsarwcgp
    ckqiapyyielsenypslmflvidvdelsdfsasweikatptffflrdgqqvdklvgank
    pelhkkitaildslppsdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d21B (B:)
    gnvhlittkerwdqklseasrdgkivlanfsarwcgpckqiapyyielsenypslmflvi
    dvdelsdfsasweikatptffflrdgqqvdklvgankpelhkkitaildsl