PDB entry 3d1z

View 3d1z on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I54M and inhibitor DARUNAVIR
Class: hydrolase
Keywords: DRUG RESISTANCE; HIV-1, flap mutant, I54M, Darunavir, HYDROLASE
Deposited on 2008-05-07, released 2008-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.15
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11682]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • see remark 999 (6)
    • see remark 999 (32)
    • engineered (53)
    • see remark 999 (62)
    • see remark 999 (66)
    • see remark 999 (94)
  Domains in SCOPe 2.05: d3d1za_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11682]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • see remark 999 (6)
    • see remark 999 (32)
    • engineered (53)
    • see remark 999 (62)
    • see remark 999 (66)
    • see remark 999 (94)
  Domains in SCOPe 2.05: d3d1zb_
• Heterogens: CL, 017, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d1zA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d1zB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf