PDB entry 3d1z

View 3d1z on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I54M and inhibitor DARUNAVIR
Class: hydrolase
Keywords: DRUG RESISTANCE; HIV-1, flap mutant, I54M, Darunavir, HYDROLASE
Deposited on 2008-05-07, released 2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.15
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11682]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (53)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.08: d3d1za_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11682]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (53)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.08: d3d1zb_
  • Heterogens: CL, 017, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d1zA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d1zB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf