PDB entry 3d1z
View 3d1z on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I54M and inhibitor DARUNAVIR
Class: hydrolase
Keywords: DRUG RESISTANCE; HIV-1, flap mutant, I54M, Darunavir, HYDROLASE
Deposited on
2008-05-07, released
2008-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.15
AEROSPACI score: 0.77
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11682]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (53)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.08: d3d1za_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11682]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (53)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.08: d3d1zb_ - Heterogens: CL, 017, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3d1zA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3d1zB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf