PDB entry 3d1x

View 3d1x on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I54M and inhibitor saquinavir
Class: hydrolase/hydrolase inhibitor
Keywords: DRUG RESISTANCE, HIV-1, I54M, Flap mutant, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Hydrolase-hydrolase inhibitor complex, Viral nucleoprotein
Deposited on 2008-05-06, released 2008-06-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.155
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • see remark 999 (6)
    • see remark 999 (32)
    • engineered (53)
    • see remark 999 (62)
    • see remark 999 (66)
    • see remark 999 (94)
  Domains in SCOPe 2.01: d3d1xa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • see remark 999 (6)
    • see remark 999 (32)
    • engineered (53)
    • see remark 999 (62)
    • see remark 999 (66)
    • see remark 999 (94)
  Domains in SCOPe 2.01: d3d1xb_
• Heterogens: CL, ROC, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d1xA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d1xB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf