PDB entry 3d1u

View 3d1u on RCSB PDB site
Description: crystal structure of putative fructosamine-3-kinase (yp_290396.1) from thermobifida fusca yx-er1 at 1.85 a resolution
Deposited on 2008-05-06, released 2008-05-20
The last revision was dated 2008-11-25, with a file datestamp of 2008-11-21.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative fructosamine-3-kinase
    Species: Thermobifida fusca [TaxId:269800]
    Gene: YP_290396.1, Tfu_2340
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47ME9 (2-287)
      • leader sequence (0-1)
  • Heterogens: CL, EDO, PEG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3d1uA (A:)
gvnsvaarvteltgrevaavaerghshrwhlyrveladgtplfvkalpddapaldglfra
ealgldwlgrsfgspvpqvagwddrtlamewvderpptpeaaerfghqlaamhlagaesf
gatwdgyigplpmdntprstwpefyaeqrilpylrraadrgaltpgdvrlvekvldaldh
lagdpepparihgdlwngnvlwqddgavvidpaahgghreadlamlalfglpyldrvrda
ynevaplaegwrariplhqlhpllvhvclfgaayrttlvdtaraalra