PDB entry 3d1k

View 3d1k on RCSB PDB site
Description: R/T intermediate quaternary structure of an antarctic fish hemoglobin in an alpha(CO)-beta(pentacoordinate) state
Class: oxygen binding
Keywords: antarctic fish hemoglobin, intermediate R/T quaternary structure, oxidation pathway, Heme, Iron, Metal-binding, Oxygen transport, Transport, Acetylation, OXYGEN BINDING
Deposited on 2008-05-06, released 2008-08-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.167
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-1
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d1ka_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-1/2
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d1kb_
  • Heterogens: ACE, CMO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d1kA (A:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d1kB (B:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
    aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflaavvsalgkqyh