PDB entry 3d14

View 3d14 on RCSB PDB site
Description: Crystal structure of mouse Aurora A (Asn186->Gly, Lys240->Arg, Met302->Leu) in complex with 1-{5-[2-(thieno[3,2-d]pyrimidin-4-ylamino)-ethyl]- thiazol-2-yl}-3-(3-trifluoromethyl-phenyl)-urea
Class: Transferase
Keywords: Aurora A, small-molecule inhibitor, Kinase, Transferase
Deposited on 2008-05-04, released 2008-08-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine kinase 6
    Species: Mus musculus [TaxId:10090]
    Gene: Aurka, Stk6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C3H8
      • expression tag (0-4)
      • engineered (53)
      • engineered (107)
    Domains in SCOPe 2.04: d3d14a_
  • Heterogens: AK1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d14A (A:)
    gplgskrqwtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyite
    lanalsychskrvihrdikpenlllgsngelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgmppfeahtyqetyrrisrveftfpdfvtegardl
    isrllkhnasqrltlaevlehpwikansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d14A (A:)
    gplgsrqwtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyitel
    analsychskrvihrdikpenlllgsngelkiadfgwsvhapscgtldylppemiegrmh
    dekvdlwslgvlcyeflvgmppfeahtyqetyrrisrveftfpdfvtegardlisrllkh
    nasqrltlaevlehpwikanss