PDB entry 3d10

View 3d10 on RCSB PDB site
Description: Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0
Class: metal binding protein
Keywords: S100B, S100, EF-hand, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2008-05-02, released 2009-04-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.212
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d10a_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d10b_
  • Heterogens: CA, ZN, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3d10A (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffehe

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3d10B (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffehe

    Sequence, based on observed residues (ATOM records): (download) 
    >3d10B (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffeh