PDB entry 3d0z

View 3d0z on RCSB PDB site
Description: Structural charcaterization of an engineered allosteric protein
Class: transferase
Keywords: protein design, engineered allostery, pH-switch, Transferase
Deposited on 2008-05-02, released 2009-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase class-mu 26 kDa isozyme
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-213)
      • engineered (49)
    Domains in SCOPe 2.08: d3d0za1, d3d0za2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3d0zA (A:)
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelghefpnlpyyid
gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
krieaipqidkylksskyiawplqgwqatfgggd