PDB entry 3d0p

View 3d0p on RCSB PDB site
Description: Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex
Class: hydrolase/DNA
Keywords: RNase H-DNA complex, A-form, B-form, metal ions, protein-DNA complex, X-ray crystallography, Cytoplasm, Endonuclease, Hydrolase, Magnesium, Manganese, Metal-binding, Nuclease, hydrolase/DNA COMPLEX
Deposited on 2008-05-02, released 2008-10-07
The last revision prior to the SCOP 1.75 freeze date was dated 2008-10-07, with a file datestamp of 2008-10-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (0-133)
      • engineered (71)
    Domains in SCOP 1.75: d3d0pa1
  • Chain 'B':
    Compound: DNA (5'-d(*dcp*dgp*dcp*dgp*dap*dap*dtp*dtp*dcp*dgp*dcp*dg)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: Ribonuclease H
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (Start-133)
      • engineered (71)
    Domains in SCOP 1.75: d3d0pc1
  • Chain 'D':
    Compound: DNA (5'-d(*dcp*dgp*dcp*dgp*dap*dap*dtp*dtp*dcp*dgp*dcp*dg)-3')
    Species: synthetic, synthetic
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3d0pA (A:)
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3d0pC (C:)
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg

    Sequence, based on observed residues (ATOM records): (download) 
    >3d0pC (C:)
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikadyg

  • Chain 'D':
    No sequence available.