PDB entry 3d0o

View 3d0o on RCSB PDB site
Description: Crystal structure of Lactate Dehydrogenase from Staphylococcus Aureus
Class: oxidoreductase
Keywords: lactate dehydrogenase, staphylococcus aureus, Cytoplasm, Glycolysis, NAD, Oxidoreductase, Phosphoprotein
Deposited on 2008-05-02, released 2009-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase 1
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: ldh1, SACOL0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d0oa1, d3d0oa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase 1
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: ldh1, SACOL0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d0ob1, d3d0ob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d0oA (A:)
    mnkfkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspt
    tvrvkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgifl
    vatnpvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehg
    dtelpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamgl
    ariteaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfa
    hsaktlkdimaeaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0oA (A:)
    fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
    vkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgiflvat
    npvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehgdte
    lpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamglari
    teaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfahsa
    ktlkdimae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d0oB (B:)
    mnkfkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspt
    tvrvkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgifl
    vatnpvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehg
    dtelpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamgl
    ariteaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfa
    hsaktlkdimaeaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0oB (B:)
    fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
    vkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgiflvat
    npvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehgdte
    lpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamglari
    teaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfahsa
    ktlkdimaea