PDB entry 3d0j

View 3d0j on RCSB PDB site
Description: Crystal structure of conserved protein of unknown function CA_C3497 from Clostridium acetobutylicum ATCC 824
Deposited on 2008-05-01, released 2008-07-01
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.166
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein CA_C3497
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C3497
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DI0 (3-139)
      • expression tag (2)
  • Heterogens: FMT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3d0jA (A:)
snamkpdiyennregilcvyknekwlvciknwkpdndiegiahleihhstdeqfilsagk
ailitaekendkfnieltlmekgkvynvpaecwfysitqkdtkmmyvqdsncsmdnsdfc
dlskeeieyiqtnarklfek

    Sequence, based on observed residues (ATOM records):
    >3d0jA (A:)
amkpdiyennregilcvyknekwlvciknwkpdndiegiahleihhstdeqfilsagkai
litaekendkfnieltlmekgkvynvpaecwfysitqkdtkmmyvqdsncsmdnsdfcdl
skeeieyiqtnarklfek