PDB entry 3d0f

View 3d0f on RCSB PDB site
Description: structure of the big_1156.2 domain of putative penicillin-binding protein mrca from nitrosomonas europaea atcc 19718
Deposited on 2008-05-01, released 2008-07-01
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding 1 transmembrane protein MrcA
    Species: Nitrosomonas europaea ATCC 19718 [TaxId:228410]
    Gene: mrcA, NE2317
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81ZZ3 (3-105)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Penicillin-binding 1 transmembrane protein MrcA
    Species: Nitrosomonas europaea ATCC 19718 [TaxId:228410]
    Gene: mrcA, NE2317
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81ZZ3 (3-105)
      • expression tag (1-2)
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3d0fA (A:)
    snayrgpeaflklpkdlkdrealqdimqdignsddilaavvlsatpgaveafrkngetir
    itgdglkaahrflsndpkigekrirpgalirvkktekgswqivqlp
    

    Sequence, based on observed residues (ATOM records):
    >3d0fA (A:)
    nayrgpeaflklpkdlkdrealqdimqdignsddilaavvlsatpgaveafrkngetiri
    tgdglkaahrflsndpkigekrirpgalirvkktekgswqivqlp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3d0fB (B:)
    snayrgpeaflklpkdlkdrealqdimqdignsddilaavvlsatpgaveafrkngetir
    itgdglkaahrflsndpkigekrirpgalirvkktekgswqivqlp
    

    Sequence, based on observed residues (ATOM records):
    >3d0fB (B:)
    nayrgpeaflklpkdlkdrealqdimqdignsddilaavvlsatpgaveafrkngetiri
    tgdglkaahrflsndpkigekrirpgalirvkktekgswqivqlp