PDB entry 3d0e

View 3d0e on RCSB PDB site
Description: Crystal structure of human Akt2 in complex with GSK690693
Class: transferase inhibitor
Keywords: human, AKT2, inhibitor, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, TRANSFERASE INHIBITOR
Deposited on 2008-05-01, released 2008-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31751 (0-334)
      • variant (328)
    Domains in SCOPe 2.05: d3d0ea_
  • Chain 'B':
    Compound: rac-beta serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31751 (0-334)
      • variant (328)
    Domains in SCOPe 2.05: d3d0eb_
  • Heterogens: G93, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d0eA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqrthfpqfdysasir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0eA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdqrthfpqfdysasir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d0eB (B:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqrthfpqfdysasir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0eB (B:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdqrthfpqfdysasir