PDB entry 3d09

View 3d09 on RCSB PDB site
Description: Human p53 core domain with hot spot mutation R249S and second-site suppressor mutations H168R and T123A
Class: transcription
Keywords: p53, Mutant protein, Loop-sheet-helix motif, Acetylation, Activator, Alternative splicing, Anti-oncogene, Apoptosis, Cell cycle, Covalent protein-RNA linkage, Cytoplasm, Disease mutation, DNA-binding, Endoplasmic reticulum, Glycoprotein, Host-virus interaction, Li-Fraumeni syndrome, Metal-binding, Methylation, Nucleus, Phosphoprotein, Polymorphism, Transcription, Transcription regulation, Ubl conjugation, Zinc
Deposited on 2008-05-01, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered (29)
      • engineered (74)
      • engineered (155)
    Domains in SCOPe 2.08: d3d09a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d09A (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvactyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqrmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d09A (A:)
    svpsqktyqgsygfrlgflhsvactyspalnkmfcqlaktcpvqlwvdstpppgtrvram
    aiykqsqrmtevvrrcphhercsdglappqhlirvegnlrveylddrntfrhsvvvpyep
    pevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrvcacpgrdr
    rteeenlr