PDB entry 3czz

View 3czz on RCSB PDB site
Description: Crystal structure of Cyanovirin-N domain B mutant
Class: antiviral protein
Keywords: CYANOVIRIN-N, SUGAR BINDING PROTEIN, HIV-INACTIVATING, GP120, Antiviral protein, Protein synthesis inhibitor
Deposited on 2008-04-30, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.165
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cyanovirin-N
  Species: Nostoc ellipsosporum [TaxId:45916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81180 (0-100)
    • engineered (40-41)
    • engineered (50)
    • engineered (56)
    • engineered (75)
    • engineered (77)
  Domains in SCOPe 2.08: d3czza_
• Chain 'B':
  Compound: Cyanovirin-N
  Species: Nostoc ellipsosporum [TaxId:45916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81180 (0-100)
    • engineered (40-41)
    • engineered (50)
    • engineered (56)
    • engineered (75)
    • engineered (77)
  Domains in SCOPe 2.08: d3czzb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3czzA (A:)
  lgkfsqtcynsaiqgsvltstcertnggyntssidlnsviaavdgslkwqgsnfieacrn
  tqlagsselaaecktaagqfvstkinlddhianidgtlkye
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3czzB (B:)
  lgkfsqtcynsaiqgsvltstcertnggyntssidlnsviaavdgslkwqgsnfieacrn
  tqlagsselaaecktaagqfvstkinlddhianidgtlkye