PDB entry 3czy

View 3czy on RCSB PDB site
Description: Crystal Structure of Human Heme Oxygenase-1 in Complex with 1-(Adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone
Class: oxidoreductase
Keywords: heme oxygenase-1 inhibitor complex, Endoplasmic reticulum, Heme, Iron, Metal-binding, Microsome, Oxidoreductase, Phosphoprotein, Polymorphism
Deposited on 2008-04-30, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.195
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3czya_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3czyb_
  • Heterogens: HEM, AD8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3czyA (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czyA (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3czyB (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czyB (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth