PDB entry 3czt

View 3czt on RCSB PDB site
Description: Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 9
Class: metal binding protein
Keywords: S100, EF-hand, Calcium, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2008-04-30, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cztx_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3cztX (X:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cztX (X:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh