PDB entry 3czr

View 3czr on RCSB PDB site
Description: Crystal Structure of Human 11-beta-Hydroxysteroid Dehydrogenase (HSD1) in Complex with Arylsulfonylpiperazine Inhibitor
Class: oxidoreductase
Keywords: oxidoreductase, 11beta, hydroxysteroid, dehydrogenase, Endoplasmic reticulum, Glycoprotein, Lipid metabolism, Membrane, Microsome, NADP, Polymorphism, Signal-anchor, Steroid metabolism, Transmembrane
Deposited on 2008-04-29, released 2008-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (13-16)
      • engineered (265)
    Domains in SCOPe 2.01: d3czra_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (14-16)
      • engineered (265)
    Domains in SCOPe 2.01: d3czrb_
  • Heterogens: NAP, CPS, 3CZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3czrA (A:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czrA (A:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgvhmqaapkeecaleiikggalrqeevyyds
    slwttllirnpsrkileflystsyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3czrB (B:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czrB (B:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyds
    slwttllirnpsrkileflysts