PDB entry 3czm

View 3czm on RCSB PDB site
Description: T. Gondii bradyzoite-specific LDH (LDH2) in complex with NAD and OXQ
Class: oxidoreductase
Keywords: Oxidoreductase, NAD-Binding, Rossmann fold, Glycolysis, NAD
Deposited on 2008-04-29, released 2009-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3czma1, d3czma2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3czmb1, d3czmb2
  • Heterogens: NAD, OXQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3czmA (A:)
    mtgtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiad
    tnvsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkky
    cplafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqa
    tvigthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgs
    ayyapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielel
    theeqecfrksvddvvelnkslaalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czmA (A:)
    tvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtnv
    svtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycpl
    afvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqatvi
    gthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgsayy
    apalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielelthe
    eqecfrksvddvvelnkslaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3czmB (B:)
    mtgtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiad
    tnvsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkky
    cplafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqa
    tvigthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgs
    ayyapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielel
    theeqecfrksvddvvelnkslaalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czmB (B:)
    gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
    vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
    lafvivvtnpldcmvkcfheasglpknmvcgmanvldsarfrrfiadqleisprdiqatv
    igthgdhmlplaryvtvngfplrefikkgkmteaklaeivertkkaggeivrllgqgsay
    yapalsaitmaqaflkdekrvlpcsvycqgeyglhdmfiglpaviggggieqvielelth
    eeqecfrksvddvvelnkslaal