PDB entry 3cz4

View 3cz4 on RCSB PDB site
Description: Native AphA class B acid phosphatase/phosphotransferase from E. coli
Class: hydrolase
Keywords: HYDROLASE, ACID PHOSPHATASE/PHOSPHOTRANSFERASE,METALLO PHOSPHATASE, Magnesium, Metal-binding, Periplasm
Deposited on 2008-04-28, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: aphA, napA, yjbP, b4055, JW4015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cz4a_
  • Heterogens: MG, ACT, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cz4A (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cz4A (A:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey