PDB entry 3cz1

View 3cz1 on RCSB PDB site
Description: Dimeric crystal structure of a pheromone binding protein from Apis mellifera in complex with the n-butyl benzene sulfonamide at pH 7.0
Class: Pheromone Binding Protein
Keywords: Honey bee, pheromone binding protein, signal transduction, queen mandibular pheromone
Deposited on 2008-04-27, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.153
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cz1a_
  • Chain 'B':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cz1b_
  • Heterogens: NBB, GOL, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cz1A (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

    Sequence, based on observed residues (ATOM records): (download) 
    >3cz1A (A:)
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3cz1B (B:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

    Sequence, based on observed residues (ATOM records): (download) 
    >3cz1B (B:)
vppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvddean
vdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi