PDB entry 3cyy

View 3cyy on RCSB PDB site
Description: the crystal structure of zo-1 pdz2 in complex with the cx43 peptide
Deposited on 2008-04-27, released 2008-09-23
The last revision was dated 2021-11-10, with a file datestamp of 2021-11-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (0-91)
      • engineered mutation (11)
  • Chain 'B':
    Compound: Tight junction protein ZO-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07157 (0-91)
      • engineered mutation (11)
  • Chain 'C':
    Compound: peptide from Gap junction alpha-1 protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: peptide from Gap junction alpha-1 protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3cyyA (A:)
akptkvtlvksakneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenms
ltdaktlierskgklkmvvqrderatllnvpd

    Sequence, based on observed residues (ATOM records):
    >3cyyA (A:)
kptkvtlvksakneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenmsl
tdaktlierskgklkmvvqr

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3cyyB (B:)
akptkvtlvksakneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenms
ltdaktlierskgklkmvvqrderatllnvpd

    Sequence, based on observed residues (ATOM records):
    >3cyyB (B:)
kptkvtlvksakneeyglrlashifvkeisqdslaardgniqegdvvlkingtvtenmsl
tdaktlierskgklkmvvqrd

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3cyyC (C:)
rprpddlei

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3cyyD (D:)
rprpddlei