PDB entry 3cyx
View 3cyx on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I50V and inhibitor saquinavira
Class: hydrolase/hydrolase inhibitor
Keywords: drug resistance; hiv-1, hydrolase-hydrolase inhibitor complex
Deposited on
2008-04-27, released
2008-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.15
AEROSPACI score: 0.84
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (49)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.05: d3cyxa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (49)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.05: d3cyxb_ - Heterogens: ROC, NA, ACY, GOL, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3cyxA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3cyxB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf