PDB entry 3cyx

View 3cyx on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I50V and inhibitor saquinavira
Class: hydrolase/hydrolase inhibitor
Keywords: drug resistance; hiv-1, hydrolase-hydrolase inhibitor complex
Deposited on 2008-04-27, released 2008-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.15
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (49)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.04: d3cyxa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (49)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.04: d3cyxb_
  • Heterogens: ROC, NA, ACY, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cyxA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cyxB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf