PDB entry 3cyx

View 3cyx on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I50V and inhibitor saquinavira
Class: hydrolase/hydrolase inhibitor
Keywords: drug resistance; hiv-1, hydrolase-hydrolase inhibitor complex
Deposited on 2008-04-27, released 2008-05-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.15
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • see remark 999 (6)
    • see remark 999 (32)
    • engineered (49)
    • see remark 999 (62)
    • see remark 999 (66)
    • see remark 999 (94)
  Domains in SCOPe 2.03: d3cyxa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • see remark 999 (6)
    • see remark 999 (32)
    • engineered (49)
    • see remark 999 (62)
    • see remark 999 (66)
    • see remark 999 (94)
  Domains in SCOPe 2.03: d3cyxb_
• Heterogens: ROC, NA, ACY, GOL, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cyxA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cyxB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf