PDB entry 3cyw

View 3cyw on RCSB PDB site
Description: Effect of Flap Mutations on Structure of HIV-1 Protease and Inhibition by Saquinavir and Darunavir
Class: hydrolase
Keywords: DRUG RESISTANCE; HIV-1, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc-finger
Deposited on 2008-04-27, released 2008-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.169
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (47)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.04: d3cywa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (47)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.04: d3cywb_
  • Heterogens: CL, 017, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cywA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmivgiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cywB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmivgiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf