PDB entry 3cyw
View 3cyw on RCSB PDB site
Description: Effect of Flap Mutations on Structure of HIV-1 Protease and Inhibition by Saquinavir and Darunavir
Class: hydrolase
Keywords: DRUG RESISTANCE; HIV-1, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc-finger
Deposited on
2008-04-27, released
2008-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.169
AEROSPACI score: 0.7
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (47)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.04: d3cywa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (47)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.04: d3cywb_ - Heterogens: CL, 017, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3cywA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmivgiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3cywB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmivgiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf