PDB entry 3cyt

View 3cyt on RCSB PDB site
Description: redox conformation changes in refined tuna cytochrome c
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1980-07-01, released 1980-09-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: cytochrome c
    Species: Thunnus alalunga [TaxId:8235]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81459 (0-102)
      • conflict (60-61)
    Domains in SCOPe 2.01: d3cyti_
  • Chain 'O':
    Compound: cytochrome c
    Species: Thunnus alalunga [TaxId:8235]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81459 (0-102)
      • conflict (60-61)
    Domains in SCOPe 2.01: d3cyto_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cytI (I:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cytO (O:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats