PDB entry 3cyt

View 3cyt on RCSB PDB site
Description: redox conformation changes in refined tuna cytochrome c
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1980-07-01, released 1980-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 1983-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: cytochrome c
    Species: Thunnus alalunga
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81459 (0-102)
      • conflict (60-61)
    Domains in SCOP 1.75: d3cyti_
  • Chain 'O':
    Compound: cytochrome c
    Species: Thunnus alalunga
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81459 (0-102)
      • conflict (60-61)
    Domains in SCOP 1.75: d3cyto_
  • Heterogens: ACE, HEM, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cytI (I:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cytO (O:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats