PDB entry 3cys

View 3cys on RCSB PDB site
Description: determination of the nmr solution structure of the cyclophilin a-cyclosporin a complex
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 1994-02-28, released 1994-08-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cysa_
  • Chain 'B':
    Compound: cyclosporin a
    Species: TOLYPOCLADIUM INFLATUM [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cysA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.