PDB entry 3cys

View 3cys on RCSB PDB site
Description: determination of the nmr solution structure of the cyclophilin a- cyclosporin a complex
Deposited on 1994-02-28, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3cysa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cysA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle