PDB entry 3cyr

View 3cyr on RCSB PDB site
Description: cytochrome c3 from desulfovibrio desulfuricans atcc 27774p
Class: electron transport
Keywords: electron transport, cytochrome
Deposited on 1997-07-24, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L915 (0-106)
      • conflict (5)
    Domains in SCOPe 2.08: d3cyra_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cyrA (A:)
    apavpnkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
    ekslyyvvhakgelkhtsclachskvvaekpelkkdltgcakskchp