PDB entry 3cyl

View 3cyl on RCSB PDB site
Description: Crystal structure of Piratoxin I (a myotoxic Lys49-PLA2) complexed with alpha-tocopherol
Class: toxin
Keywords: Lys49-PLA2, Bothrops pirajai, sanke venom, x-ray crystallography, alpha-tocopherol, PrTX-I, Myotoxin, Secreted, Toxin
Deposited on 2008-04-25, released 2009-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog 2
    Species: Bothrops pirajai [TaxId:113192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cyla_
  • Chain 'B':
    Compound: Phospholipase A2 homolog 2
    Species: Bothrops pirajai [TaxId:113192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cylb_
  • Heterogens: SO4, VIT, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cylA (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cylB (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c