PDB entry 3cyk

View 3cyk on RCSB PDB site
Description: Crystal structure of the F87M/L110M mutant of human transthyretin at pH 4.6.
Class: Thyroid hormone binding protein
Keywords: transthyretin, monomer, amyloidogenic intermediate, acidic pH, Thyroid hormone binding protein
Deposited on 2008-04-25, released 2008-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.159
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered (77)
      • engineered (100)
    Domains in SCOPe 2.07: d3cyka_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • engineered (77)
      • engineered (100)
    Domains in SCOPe 2.07: d3cykb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered (77)
      • engineered (100)
    Domains in SCOPe 2.07: d3cykc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • engineered (77)
      • engineered (100)
    Domains in SCOPe 2.07: d3cykd_
  • Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cykA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cykB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cykB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cykC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cykD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cykD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn