PDB entry 3cyh

View 3cyh on RCSB PDB site
Description: cyclophilin a complexed with dipeptide ser-pro
Class: complex (isomerase/dipeptide)
Keywords: cyclophilin, complex, binding protein for cyclosporin a
Deposited on 1996-02-27, released 1996-07-11
The last revision prior to the SCOP 1.75 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: HOMO SAPIENS
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cyha_
  • Chain 'B':
    Compound: dipeptide ser-pro
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cyhA (A:)
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

  • Chain 'B':
    No sequence available.