PDB entry 3cxy

View 3cxy on RCSB PDB site
Description: Crystal structure of the cytochrome P450 CYP121 P346L mutant from M. tuberculosis
Class: oxidoreductase
Keywords: Cytochrome P450, CYP121, Mycobacterium tuberculosis, Cytoplasm, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2008-04-25, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.154
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium tuberculosis H37Rv
    Gene: cyp121
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A514 (Start-395)
      • engineered (345)
    Domains in SCOPe 2.07: d3cxya_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cxyA (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfclgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxyA (A:)
    tvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmk
    etaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldn
    litegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwd
    rdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsflt
    talisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkge
    lvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfclgsalgrrhaqigieall
    kkmpgvdlavpidqlvwrtrfqrriperlpvlw