PDB entry 3cxi

View 3cxi on RCSB PDB site
Description: Structure of BthTX-I complexed with alpha-tocopherol
Class: toxin
Keywords: Myotoxin, Bothrops jaracussu, Lys49-PLA2, snake venom, Phospholipase A2, x-ray crystallography, Secreted
Deposited on 2008-04-24, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myotoxic phospholipase A2-like
  Species: Bothrops jararacussu
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q804D7 (0-120)
  Domains in SCOPe 2.07: d3cxia_
• Chain 'B':
  Compound: Myotoxic phospholipase A2-like
  Species: Bothrops jararacussu
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q804D7 (0-120)
  Domains in SCOPe 2.07: d3cxib_
• Heterogens: SO4, VIT, PE4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cxiA (A:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cxiB (B:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c