PDB entry 3cxh

View 3cxh on RCSB PDB site
Description: Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Class: oxidoreductase
Keywords: COMPLEX III, CYTOCHROME C ISOFORM-2, ELECTRON TRANSFER COMPLEX, CYTOCHROME BC1 COMPLEX, MITOCHONDRIALTRANSMEMBRANE COMPLEX, RESPIRATORY CHAIN, TRANSIENT PROTEIN-PROTEIN INTERACTION, Electron transport, Inner membrane, Mitochondrion, Transit peptide, Transport, Phosphoprotein, Heme, Iron, Metal-binding, 2Fe-2S, Iron-sulfur, Oxidoreductase
Deposited on 2008-04-24, released 2008-05-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07256 (0-430)
      • conflict (126)
    Domains in SCOPe 2.05: d3cxha1, d3cxha2
  • Chain 'B':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhb1, d3cxhb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhc1, d3cxhc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhd1, d3cxhd2
  • Chain 'E':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhe1, d3cxhe2
  • Chain 'F':
    Compound: Cytochrome b-c1 complex subunit 6
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhf_
  • Chain 'G':
    Compound: Cytochrome b-c1 complex subunit 7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhg_
  • Chain 'H':
    Compound: Cytochrome b-c1 complex subunit 8
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhh_
  • Chain 'I':
    Compound: Cytochrome b-c1 complex subunit 9
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhi_
  • Chain 'J':
    Compound: heavy chain (vh) of fv-fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CXH (0-126)
    Domains in SCOPe 2.05: d3cxhj_
  • Chain 'K':
    Compound: light chain (vl) of fv-fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CXH (0-106)
    Domains in SCOPe 2.05: d3cxhk_
  • Chain 'L':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07256 (0-430)
      • conflict (126)
    Domains in SCOPe 2.05: d3cxhl1, d3cxhl2
  • Chain 'M':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhm1, d3cxhm2
  • Chain 'N':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhn1, d3cxhn2
  • Chain 'O':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxho1, d3cxho2
  • Chain 'P':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhp1, d3cxhp2
  • Chain 'Q':
    Compound: Cytochrome b-c1 complex subunit 6
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhq_
  • Chain 'R':
    Compound: Cytochrome b-c1 complex subunit 7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhr_
  • Chain 'S':
    Compound: Cytochrome b-c1 complex subunit 8
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhs_
  • Chain 'T':
    Compound: Cytochrome b-c1 complex subunit 9
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxht_
  • Chain 'U':
    Compound: heavy chain (vh) of fv-fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CXH (0-126)
    Domains in SCOPe 2.05: d3cxhu_
  • Chain 'V':
    Compound: light chain (vl) of fv-fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CXH (0-106)
    Domains in SCOPe 2.05: d3cxhv_
  • Chain 'W':
    Compound: Cytochrome c iso-2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cxhw_
  • Heterogens: SUC, UMQ, HEM, SMA, 8PE, CN6, 9PE, 7PH, FES, 6PH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhA (A:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhB (B:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhC (C:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cxhD (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhD (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhE (E:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cxhF (F:)
    gmlelvgeyweqlkitvvpvvaaaedddneqheekaaegeekeeengdedededededdd
    ddddedeeeeeevtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehke
    dcveeffhlqhyldtataprlfdklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhF (F:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3cxhG (G:)
    pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
    rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
    nievsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhG (G:)
    qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
    lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
    ievsk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhH (H:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3cxhI (I:)
    sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaagdg
    dddde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhI (I:)
    sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhJ (J:)
    evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
    npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
    ssawrhp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhK (K:)
    dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
    rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhL (L:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhM (M:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhN (N:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3cxhO (O:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhO (O:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkp
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhP (P:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3cxhQ (Q:)
    gmlelvgeyweqlkitvvpvvaaaedddneqheekaaegeekeeengdedededededdd
    ddddedeeeeeevtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehke
    dcveeffhlqhyldtataprlfdklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhQ (Q:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3cxhR (R:)
    pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
    rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
    nievsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhR (R:)
    qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
    lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
    ievsk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhS (S:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3cxhT (T:)
    sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaagdg
    dddde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cxhT (T:)
    sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhU (U:)
    evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
    npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
    ssawrhp
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhV (V:)
    dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
    rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cxhW (W:)
    akestgfkpgsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytda
    ninknvkwdedsmseyltnpkkyipgtkmafaglkkekdrndlitymtkaak