PDB entry 3cx8

View 3cx8 on RCSB PDB site
Description: Crystal Structure of PDZRhoGEF rgRGS Domain in a Complex with Galpha-13 Bound to GTP-gamma-S
Class: signaling protein
Keywords: SIGNAL TRANSDUCTION, PROTEIN COMPLEX, GTP-binding, Lipoprotein, Membrane, Nucleotide-binding, Palmitate, Phosphoprotein, Transducer, Coiled coil, Cytoplasm, GTPase activation, Guanine-nucleotide releasing factor, SIGNALING PROTEIN
Deposited on 2008-04-23, released 2008-10-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein alpha-13 subunit
    Species: MUS MUSCULUS
    Gene: Gna13, Gna-13
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 11
    Species: Rattus norvegicus
    Gene: Arhgef11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3cx8b_
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cx8B (B:)
    gliigpeedydpgyfnnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsev
    yqqtnpkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeav
    mleiqeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedr
    sapmdfavntfmshagirlresr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cx8B (B:)
    liigpeedydpgnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevyqqt
    npkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeavmlei
    qeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrsapm
    dfavntfmshagi