PDB entry 3cx2

View 3cx2 on RCSB PDB site
Description: Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
Class: contractile protein
Keywords: myosin-binding protein; protonation states, Actin-binding, Cardiomyopathy, Cell adhesion, Disease mutation, Immunoglobulin domain, Muscle protein, Phosphoprotein, Polymorphism, Thick filament, CONTRACTILE PROTEIN
Deposited on 2008-04-23, released 2008-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.164
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, cardiac-type
    Species: HOMO SAPIENS
    Gene: MYBPC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cx2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cx2A (A:)
    ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
    dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cx2A (A:)
    ddpiglfvmrpqdgevtvggsitfsarvagallkppvvkwfkgkwvdlsskvgqhlqlhd
    sydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe