PDB entry 3cx2

View 3cx2 on RCSB PDB site
Description: Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
Class: contractile protein
Keywords: myosin-binding protein; protonation states, Actin-binding, Cardiomyopathy, Cell adhesion, Disease mutation, Immunoglobulin domain, Muscle protein, Phosphoprotein, Polymorphism, Thick filament, CONTRACTILE PROTEIN
Deposited on 2008-04-23, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myosin-binding protein C, cardiac-type
  Species: Homo sapiens [TaxId:9606]
  Gene: MYBPC3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14896 (0-107)
  Domains in SCOPe 2.08: d3cx2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3cx2A (A:)
  ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
  dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3cx2A (A:)
  ddpiglfvmrpqdgevtvggsitfsarvagallkppvvkwfkgkwvdlsskvgqhlqlhd
  sydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe