PDB entry 3cx2
View 3cx2 on RCSB PDB site
Description: Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
Class: contractile protein
Keywords: myosin-binding protein; protonation states, Actin-binding, Cardiomyopathy, Cell adhesion, Disease mutation, Immunoglobulin domain, Muscle protein, Phosphoprotein, Polymorphism, Thick filament, CONTRACTILE PROTEIN
Deposited on
2008-04-23, released
2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Myosin-binding protein C, cardiac-type
Species: Homo sapiens [TaxId:9606]
Gene: MYBPC3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3cx2a_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3cx2A (A:)
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
Sequence, based on observed residues (ATOM records): (download)
>3cx2A (A:)
ddpiglfvmrpqdgevtvggsitfsarvagallkppvvkwfkgkwvdlsskvgqhlqlhd
sydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe