PDB entry 3cwm

View 3cwm on RCSB PDB site
Description: Crystal structure of alpha-1-antitrypsin complexed with citrate
Class: protease inhibitor
Keywords: antitrypsin, polymerisation, protein aggregation, protein unfolding, serpin, acute phase, disease mutation, glycoprotein, protease inhbitor, secreted, serine protease inhibitor, Blood coagulation, PROTEASE INHIBITOR
Deposited on 2008-04-22, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1, AAT, PI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cwma_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cwmA (A:)
    edpqgdaaqktdtshhdqdhptfnkitpnlaefafslyrqlahqsnstniffspvsiata
    famlslgtkadthdeileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglfl
    seglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdt
    vfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvl
    lmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlk
    svlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipmsi
    ppevkfnkpfvflmieqntksplfmgkvvnptqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cwmA (A:)
    nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
    lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
    tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
    eeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhl
    enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
    eaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntkspl
    fmgkvvnptq