PDB entry 3cwi

View 3cwi on RCSB PDB site
Description: Crystal structure of thiamine biosynthesis protein (ThiS) from Geobacter metallireducens. Northeast Structural Genomics Consortium Target GmR137
Deposited on 2008-04-21, released 2008-05-06
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-biosynthesis protein ThiS
    Species: Geobacter metallireducens GS-15 [TaxId:269799]
    Gene: ThiS, Gmet_1567
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3cwiA (A:)
mnltvngkpstvdgaeslnvtellsalkvaqaeyvtvelngevlereafdattvkdgdav
eflyfmgggklehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3cwiA (A:)
mnltvngkpstvdgaeslnvtellsalkvaqaeyvtvelngevlereafdattvkdgdav
eflyfmggg