PDB entry 3cw7

View 3cw7 on RCSB PDB site
Description: Crystal Structure of an AlkA Host/Guest Complex 8oxoGuanine:Cytosine Base Pair
Class: hydrolase/DNA
Keywords: AlkA, 8oxoguanine, DNA repair, host/guest complex, DNA structure, DNA damage, Hydrolase, hydrolase/DNA COMPLEX
Deposited on 2008-04-21, released 2008-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cw7a1, d3cw7a2
  • Chain 'B':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cw7b1, d3cw7b2
  • Chain 'C':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cw7c1, d3cw7c2
  • Chain 'D':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cw7d1, d3cw7d2
  • Chain 'E':
    Compound: DNA (5'-d(*dgp*dap*dcp*dap*dtp*dgp*dap*(8og)p*dtp*dgp*dcp*dc)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*dgp*dgp*dcp*dap*dcp*dtp*dcp*dap*dtp*dgp*dtp*dc)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*dgp*dap*dcp*dap*dtp*dgp*dap*(8og)p*dtp*dgp*dcp*dc)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*dgp*dgp*dcp*dap*dcp*dtp*dcp*dap*dtp*dgp*dtp*dc)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw7A (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw7B (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw7C (C:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw7D (D:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.