PDB entry 3cw3

View 3cw3 on RCSB PDB site
Description: crystal structure of aim1g1
Deposited on 2008-04-21, released 2008-06-17
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Absent in melanoma 1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: AIM1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3cw3A (A:)
gkvviysepdvsekcievfsdiqdcsswslspvilikvvrgcwilyeqpnfeghsiplee
gelelsglwgiedilerheeaesdkpvvigsirhvv

    Sequence, based on observed residues (ATOM records):
    >3cw3A (A:)
gkvviysepekcievfsdiqdcsswslspvilikvvrgcwilyeqpnfeghsipleegel
elsglwgiedilerheeaesdkpvvigsirhvv