PDB entry 3cvq

View 3cvq on RCSB PDB site
Description: Structure of Peroxisomal Targeting Signal 1 (PTS1) binding domain of Trypanosoma brucei Peroxin 5 (TbPEX5)complexed to PTS1 peptide (7-SKL)
Class: transport protein
Keywords: TPR motifs, TPR protein, Peroxin 5, PEX5, PTS1 binding domain, Protein-peptide complex, Receptor, TPR repeat, TRANSPORT PROTEIN
Deposited on 2008-04-18, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.275
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome targeting signal 1 receptor PEX5
    Species: Trypanosoma brucei
    Gene: PEX5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U7C3
      • engineered (82)
      • engineered (86)
    Domains in SCOPe 2.06: d3cvqa_
  • Chain 'B':
    Compound: PTS1 peptide 7-SKL (Ac-SNRWSKL)
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVQ (0-6)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cvqA (A:)
    ghmlqnntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrs
    lgltqaenekdglaiialnharaldpadiavhaalavshtnehnanaalaslrawllsqp
    qyeqlgsvnlqadvdiddlnvqsedfffaapneyrecrtllhaalemnpndaqlhaslgv
    lynlsnnydsaaanlrravelrpddaqlwnklgatlangnrpqealdaynraldinpgyv
    rvmynmavsysnmsqydlaakqlvraiymqvggttptgeasreatrsmwdffrmllnvmn
    rpdlveltyaqnvepfakefglqsmll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cvqA (A:)
    ntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltqa
    enekdglaiialnharaldpadiavhaalavshtnehnanaalaslrawllsqpqyeqlg
    svnedfffaapneyrecrtllhaalemnpndaqlhaslgvlynlsnnydsaaanlrrave
    lrpddaqlwnklgatlangnrpqealdaynraldinpgyvrvmynmavsysnmsqydlaa
    kqlvraiymqvatrsmwdffrmllnvmnrpdlveltyaqnvepfakefg
    

  • Chain 'B':
    No sequence available.