PDB entry 3cvm

View 3cvm on RCSB PDB site
Description: High resolution structure of a stable Plasminogen activator inhibitor type-1 in its protease cleaved form
Class: blood clotting
Keywords: Plasminogen activator inhibitor type-1, cleaved serpin, Glycoprotein, Plasminogen activation, Polymorphism, Protease inhibitor, Secreted, Serine protease inhibitor, BLOOD CLOTTING
Deposited on 2008-04-18, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.229
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: HOMO SAPIENS
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-391)
      • variant (22)
      • engineered (162)
      • engineered (166)
      • engineered (331)
      • engineered (366)
    Domains in SCOPe 2.08: d3cvma_
  • Chain 'B':
    Compound: Plasminogen activator inhibitor 1
    Species: HOMO SAPIENS
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-391)
      • variant (22)
      • engineered (162)
      • engineered (166)
      • engineered (331)
      • engineered (366)
    Domains in SCOPe 2.08: d3cvmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cvmA (A:)
    mrgshhhhhhgsavhhppsyvarlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlq
    lttggetqqqiqaamgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvq
    gfmphffrlfrstvkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvn
    alyfngqwktpfpdssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelp
    yhgdtlsmfiaapyekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlr
    kplenlgmtdmfrqfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarm
    apeeiiidrpflfvvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cvmA (A:)
    avhhppsyvarlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiq
    aamgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrs
    tvkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpf
    pdssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaa
    pyekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmf
    rqfqadftslsdqeplhvalalqkvkievnesgtvassstavivsareeiiidrpflfvv
    rhnptgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cvmB (B:)
    mrgshhhhhhgsavhhppsyvarlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlq
    lttggetqqqiqaamgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvq
    gfmphffrlfrstvkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvn
    alyfngqwktpfpdssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelp
    yhgdtlsmfiaapyekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlr
    kplenlgmtdmfrqfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarm
    apeeiiidrpflfvvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cvmB (B:)
    avhhppsyvarlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiq
    aamgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrs
    tvkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpf
    pdssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaa
    pyekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmf
    rqfqadftslsdqeplhvalalqkvkievnesgtvassstavivsareeiiidrpflfvv
    rhnptgtvlfmgqvmep